PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn352661
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 1220aa    MW: 136831 Da    PI: 6.4312
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn352661genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like44.34e-14217253137
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmk 37 
                 kpr+rWtpeLHe+Fveav++LGGse+ t k++  + +
  Achn352661 217 KPRMRWTPELHEAFVEAVNRLGGSERSTEKKLTPMEE 253
                 79***************************99876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-11216249IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-7217248IPR006447Myb domain, plants
PfamPF143794.4E-23263309IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
SuperFamilySSF578508.83E-33440516No hitNo description
Gene3DG3DSA:3.30.40.109.4E-29440524IPR013083Zinc finger, RING/FYVE/PHD-type
PfamPF145692.5E-36447515IPR027934Cellulose synthase, RING-type zinc finger
PROSITE profilePS500898.801450496IPR001841Zinc finger, RING-type
PfamPF035528.5E-56725827IPR005150Cellulose synthase
PfamPF035529.0E-229121019IPR005150Cellulose synthase
PfamPF035521.5E-9510221212IPR005150Cellulose synthase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030244Biological Processcellulose biosynthetic process
GO:0016020Cellular Componentmembrane
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0016760Molecular Functioncellulose synthase (UDP-forming) activity
Sequence ? help Back to Top
Protein Sequence    Length: 1220 aa     Download sequence    Send to blast
MELLEHYHHL YPFFLLGWKR SIISIPTPNS NEVVGPMFSS TSGFSSNLHY SSISPTGKHT  60
RKSPFIYQSS NNGESLPLTL CDSRMLQSTS NNESWCRDSL PNFFDYPANT PVRNTQLGSS  120
SNGDSSMATE DLGKRSDWQN WADQLITDDD SLTSNWNDFF ADSNVEDPEP KVAFQVAKPS  180
INVLTTQPQV LGQIPLPSGE SSSAPNTTSL PGGAPTKPRM RWTPELHEAF VEAVNRLGGS  240
ERSTEKKLTP MEELASLDLK TGIEITEALR LQIEVQKRLH EQLEIQKSLQ LRIEEQGRCL  300
QMMFEKQCTA GGMLKTSPSS LEIPSADAKD TVPNSPDKNE SGTSQLDHEE KENVIAASVP  360
PSRKLGKKQK LQESEVSEDV EENVVEGSSS QPLKRAKAET CLSLPLPLPC FWLAMAGLFA  420
GSHGRNELHV LHSKDEPRSP THGQKLAKIC RVCSDEIGLK VNGEMFVACH ECGFPVCRPC  480
YEYERSEGNQ SCPQCNTRYK RHKGCARVDG DEEDNFDAED FDDEFQIKHQ QHSPDHHHQA  540
ANHSENGDNN QQKWHHNASP SSFASVAGSV DGGKEFEGEK ETNTNNAEWK ERVEKWKTRQ  600
EKRGMSNKDD EGNEQGDDDD EYLTAEARQP LWRKVPISSS LINPYRIVIV LRLIILAFFF  660
RFRILTPAHD AYPLWLISVI CEIWFGFSWI LDQFPKWLPI TRETYLDRLS LRFEREGEPN  720
RLAPVDVYVS TVDPLKEPPI ITANTVLSIL AVDYPVENVS CYVSDDGASM LLFDALAETA  780
EFARRWVPFC KKYAVEPRTP EFYFSEKIDY LKDKVQPTFV KDRRAMKVYL GSEGALDVEG  840
KELPKLVYVS REKRPGYQHH KKAGAMNAMV YLGSEGALDV EGKELPKLVY VSREKRPGYQ  900
HHKKAGAMNA MINMKGLDGI QGPVYVGTGC VFNRPALYGY DPPVSEKRQK MTCDCLSSWC  960
CCCCGGSRKK SKSKKKGLKA LLGLGGLYSK KKKIMGKNYS RKSSSGPVFD LEEIEEGLEG  1020
LYFYAQLNNL ASIWFMALFL SIIVTGVLEL RWSGVSIQDW WRNEQFWVIG GVSAHLFAVF  1080
QGLLKVLAGV DTNFTVTAKA AEDAEFGELY LFKWTTLLIP PTTLIILNMV GVVAGVSDAI  1140
NNGYGSWGPL FGKLLFAFWV IVHLYPFLKG LMGRQNRTPT IVVLWSILLA SIFSLIWVRI  1200
DPFLPKQTGP ILKQCGVEC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1weo_A5e-244475081677cellulose synthase, catalytic subunit (IRX3)
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1973992KKKGLKALLGLGGLYSKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010091789.10.0OsCesA4 protein
SwissprotQ84JA60.0CESA4_ARATH; Cellulose synthase A catalytic subunit 4 [UDP-forming]
TrEMBLW9RB710.0W9RB71_9R
STRINGVIT_07s0005g04110.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.13e-60phosphate starvation response 1